PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G089200.1.p
Common NameGLYMA_08G089200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 758aa    MW: 84836.1 Da    PI: 5.9274
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G089200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.9e-171664856
                         -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         ++  +  Le+ F++++yp++++r++++++l+L+ +qVk+WFqNr++k k
  Glyma.08G089200.1.p 16 NHATVSKLEAIFRECPYPNENRRRQISEELELSLNQVKFWFQNRKTKLK 64
                         6677899****************************************88 PP

2START130.22.4e-412774962206
                          HHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
                START   2 laeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                          +a+ a +el+k+ + ++p+W+       +++d + +++ + +       ++e +++s++vdm++++lv+ +++   +W   ++    ka+
  Glyma.08G089200.1.p 277 IANNAIEELIKLLDMNQPFWSIHDwkLVLKRDNYQSILGRRHClpgphARIESSKDSRIVDMNAEQLVQMFMNLE-KWVDLFPtivtKAQ 365
                          6889999*************98887745666666666655555777889**************************.99999988889*** PP

                          EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
                START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                          t++v+++g      gal l++ae+  ls+lvp R f+f+Ry++q ++g+wvi dvS+ds ++++    v R  ++pSg+li+++  g +k
  Glyma.08G089200.1.p 366 TIQVLENGlvgnrsGALLLINAEMHILSHLVPtRQFYFLRYCKQIKEGVWVIGDVSIDSLEYKTI---VPRIWRRPSGCLIQEMNHGLCK 452
                          ***************************************************************98...888888**************** PP

                          EEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 164 vtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          v wvehv++++++  h+l+  ++    a ga +w++tl+r ce+
  Glyma.08G089200.1.p 453 VSWVEHVEVDDKMQtHQLFTDVICCNNAYGAERWLSTLKRMCER 496
                          *************99***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.1E-13870IPR001356Homeobox domain
SuperFamilySSF466892.09E-141469IPR009057Homeodomain-like
CDDcd000866.32E-141464No hitNo description
PfamPF000461.4E-141664IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-151669IPR009057Homeodomain-like
PROSITE profilePS5007114.8192066IPR001356Homeobox domain
PROSITE patternPS0002704164IPR017970Homeobox, conserved site
PROSITE profilePS5084837.566267499IPR002913START domain
SuperFamilySSF559612.56E-28268497No hitNo description
CDDcd088752.10E-87272495No hitNo description
Gene3DG3DSA:3.30.530.202.6E-6274461IPR023393START-like domain
SMARTSM002342.6E-27276496IPR002913START domain
PfamPF018521.0E-33277496IPR002913START domain
SuperFamilySSF559613.2E-11520720No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MYPSNLGGSG RGNRLNHATV SKLEAIFREC PYPNENRRRQ ISEELELSLN QVKFWFQNRK  60
TKLKAISERI DNNALRRENE NIQSENLLMR ESLQNAFCLS CGGLPVGSVE RKLQLQSLKA  120
KNIQLAKEAR GRLLNPIVGL PSPYQHSHVL STPGFNQDIP APAPALDCYI PDPPSDDVAL  180
DYCIPTPASV LAVDHSIPAL ASDPWLGQDI PHLPTLATLD QDIPPLGQDT STLPQDHMPK  240
DLDQELDALR GILNNDLIFQ SIINQRIDLD NAMMSQIANN AIEELIKLLD MNQPFWSIHD  300
WKLVLKRDNY QSILGRRHCL PGPHARIESS KDSRIVDMNA EQLVQMFMNL EKWVDLFPTI  360
VTKAQTIQVL ENGLVGNRSG ALLLINAEMH ILSHLVPTRQ FYFLRYCKQI KEGVWVIGDV  420
SIDSLEYKTI VPRIWRRPSG CLIQEMNHGL CKVSWVEHVE VDDKMQTHQL FTDVICCNNA  480
YGAERWLSTL KRMCERFACA SAETIPSCDE SGEAILSLEG KKSVMHLAHR MVKTFCRTLD  540
VSDCENFPYL TRMMNNGEVT IIVRKNNSEQ DVPQGLILSA ATSFLLPHSP ENVFDFLIDN  600
KKRAKWEPFW YGKPGHEIQR ISTGNNPGNF ISITKALGPS DNNMIVLQES YADGLGSMMV  660
YSAFDTETMN FAMRGEDTSQ LLVLPSGFTI SGDGHSNAFE GQSRQVVSKG SLVTLMLQVL  720
ASSTPSMDMI DMEFVGSVTT LVSSTVEKIK AALNCSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358830.0AC235883.2 Glycine max clone GM_WBc0013D02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585049.20.0PREDICTED: homeobox-leucine zipper protein HDG12-like
TrEMBLA0A0R0IJ930.0A0A0R0IJ93_SOYBN; Uncharacterized protein
STRINGGLYMA08G09430.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34650.11e-118homeodomain GLABROUS 10